derivatization comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Commercial glutathione is produced by microbial fermentation or chemical synthesis, then purified. Reduced and oxidized grades are offered separately, with purity specifications often exceeding 98 percent. The compound appears in foods such as fresh fruits, vegetables, and meats, although cooking and processing can lower amounts. Oral, topical, and inhaled forms are discussed in research and consumer contexts, but absorption and tissue delivery remain active areas of study. Regulatory status varies by country and intended use.
Glutathione is a small sulfur-containing peptide built from glutamic acid, cysteine, and glycine. Its distinctive feature is a gamma-glutamyl bond between glutamate's side-chain carboxyl group and cysteine's amino group. This linkage resists ordinary peptidases and helps the molecule remain stable inside cells. The reduced thiol form, often abbreviated GSH, is the dominant intracellular species. The oxidized disulfide dimer, GSSG, forms when two reduced molecules link through their cysteine sulfur atoms. The balance between these forms is a common redox indicator.
Glutathione is synthesized in two ATP-dependent steps. First, gamma-glutamylcysteine synthetase links glutamate and cysteine; second, glutathione synthetase adds glycine to form the complete tripeptide. The pathway is feedback-inhibited by GSH itself, which helps maintain steady intracellular levels. Tissues vary widely in glutathione content, with the liver typically containing the highest concentrations, followed by the kidneys, lungs, and erythrocytes. Because cysteine is often limiting, its availability influences synthesis rates, and regulation of this pathway varies by cell type.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine, and it is the most abundant non-protein thiol in most living cells. The reduced form, GSH, carries a sulfhydryl group that can donate electrons, while the oxidized form, GSSG, forms when two GSH molecules link via a disulfide bond. The balance between these two forms helps define the cellular redox environment, and their ratio is often used as an indicator of oxidative stress. Because the sulfhydryl group is reactive, glutathione participates in many cellular processes, including detoxification and protein regulation.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Reduced glutathione (GSH) |
| Molar mass | 307.32 g/mol | Oxidized dimer GSSG is 612.63 g/mol |
| Appearance | White to off-white crystalline powder | Typical purified solid |
| Solubility | Freely soluble in water; practically insoluble in ethanol | Polarity reflects multiple ionizable groups |
| Common synonyms | GSH; L-glutathione; γ-glutamylcysteinylglycine | 'Reduced' distinguishes it from GSSG |
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Quantification of glutathione in biological or food samples commonly uses liquid chromatography coupled to ultraviolet, fluorescence, electrochemical, or mass spectrometric detection. Because the thiol group oxidizes readily, samples are often acidified or derivatized immediately after collection to stabilize reduced glutathione. Enzymatic recycling assays and colorimetric kits offer higher throughput but generally lower specificity than chromatographic methods. Mass spectrometry can distinguish glutathione from related thiols and allow simultaneous measurement of oxidized forms. Reported concentrations depend strongly on sample type, extraction procedure, and analytical platform.
Glutathione reference materials are sensitive to oxygen, light, and elevated temperature. Solid material is typically stored desiccated at -20 °C or below, while solutions require tighter control because thiol oxidation proceeds faster in liquid form. Aqueous solutions are often prepared fresh, kept cold, and protected from air; some protocols add acid or chelating agents to slow metal-catalyzed oxidation. Repeated freeze-thaw cycles can accelerate degradation and should be avoided. Stability data vary by matrix, so laboratories usually verify performance with their own storage conditions.
Quality control for glutathione measurements includes calibration with authenticated standards, internal standards where available, blank correction, and spike recovery checks. Because glutathione can form during sample processing or degrade before analysis, pre-analytical handling is a major source of variability. Interlaboratory comparisons often show differences in reported values due to method-specific calibration and detection principles. Interpretive thresholds are context-dependent, and no single reference range applies across all tissues or matrices. Researchers generally report both reduced and oxidized forms, along with the method and sample handling details.
For solid glutathione, storage conditions affect shelf life. The reduced form is typically kept cool, dry, and protected from air and light. Moisture can promote oxidation, while elevated temperatures accelerate degradation. Suppliers often specify storage at or below freezing, sometimes under inert gas. Solutions are less stable than powders and may require preparation shortly before use. Buffers and chelating agents can slow oxidation, but they do not eliminate it. Published stability data vary with matrix, pH, and container.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
== In popular culture == The 1993 film Jurassic Park (based on the 1990 Michael Crichton novel of the same name) features dinosaurs that were genetically altered so that they could not produce the amino acid lysine. This was known as the "lysine contingency" and was supposed to prevent the cloned dinosaurs from surviving outside the park, forcing them to be dependent on lysine supplements provided by the park's veterinary staff. In reality, no animals are capable of producing lysine (it is an essential amino acid).
Shaka was the illegitimate son of Senzangakhona, Chief of the Zulus. He was born c. 1787. He and his mother, Nandi, were exiled by Senzangakhona, and found refuge with the Mthethwa. Shaka fought as a warrior under Dingiswayo, leader of the Mthethwa Paramountcy. When Senzangakona died, Dingiswayo helped Shaka become king of the Zulu. After Dingiswayo's death at the hands of Zwide, king of the Ndwandwe, around 1816, Shaka assumed leadership of the entire Mthethwa alliance. Shaka expanded the Zulu Kingdom through war and diplomacy. Shaka's clan at first numbered no more than a few thousands, but eventually grew in size to 45,000 after absorbing neighbouring clans. His military reforms included new battle techniques, training, and tough discipline, as well as the replacement of long throwing spears in exchange for the more effective short stabbing spears. Conscripted men were segregated from the rest of Zulu society to be trained as an organised standing army called the amabutho. The alliance under his leadership survived Zwide's first assault at the Battle of Gqokli Hill (1818). Within two years, Shaka had defeated Zwide at the Battle of Mhlatuze River (1820) and broken up the Ndwandwe alliance. The Ngoni people fled as far north as Tanzania and Malawi. By 1822, Shaka had conquered an empire covering an area of around 80,000 square miles (210,000 km2), covering Pongola to the Tugera Rivers.
==== Metabolism ==== Ramelteon is metabolized in the liver primarily by oxidation via hydroxylation and carbonylation. It is also secondarily metabolized to produce glucuronide conjugates. Ramelteon is metabolized mainly by CYP1A2 while CYP2C enzymes and CYP3A4 are involved to a minor extent. The metabolites of ramelteon include M-I, M-II, M-III, and M-IV. Exposure to M-II is approximately 20- to 100-fold higher than to ramelteon.
=== Processes === Various methods can be used for decaffeination of coffee. These methods take place prior to roasting and may use organic solvents such as dichloromethane or ethyl acetate, supercritical CO2, or water to extract caffeine from the beans, while leaving flavour precursors in as close to their original state as possible.
Sources: en.wikipedia.org
In October 2025, Moore announced an agreement between the state and Constellation Energy that would allow the Conowingo Dam to continue operations for another 50 years, but required the company to spend $341 million on a series of renovations to support fish migration through the damn and limit pollution flowing through it to the lower Susquehanna River and the Chesapeake Bay.
=== Arthritis === CCN1 is highly expressed in collagen-induced arthritis in rodents, and inhibition of CCN1 expression correlates with suppression of inflammatory arthritis. CCN1 is also found in articular cartilage from patients with osteoarthritis and appears to suppress ADAMTS4 (aggrecanase) activity, possibly leading to cartilage cell (chondrocyte) cloning.
Sugar cane requires a frost-free climate with sufficient rainfall during the growing season to make full use of the plant's substantial growth potential. The crop is harvested mechanically or by hand, chopped into lengths and conveyed rapidly to the processing plant (commonly known as a sugar mill) where it is either milled and the juice extracted with water or extracted by diffusion. The juice is clarified with lime and heated to destroy enzymes. The resulting thin syrup is concentrated in a series of evaporators, after which further water is removed. The resulting supersaturated solution is seeded with sugar crystals, facilitating crystal formation and drying. Molasses is a by-product of the process and the fibre from the stems, known as bagasse, is burned to provide energy for the sugar extraction process. The crystals of raw sugar have a sticky brown coating and either can be used as they are, can be bleached by sulfur dioxide, or can be treated in a carbonatation process to produce a whiter product. About 2,500 litres (660 US gal) of irrigation water is needed for every one kilogram (2.2 pounds) of sugar produced.
Sources: en.wikipedia.org
Elion (1918–1999), American biochemist and recipient of the 1988 Nobel Prize in Physiology or Medicine for innovative methods of rational drug design Conrad Elvehjem (1901–1962), American biochemist who identified two vitamins, nicotinic acid (niacin) and nicotinamide Harry Julius Emeléus (1903–1993), British inorganic chemist known for work on fluorine chemistry Gladys Anderson Emerson (1903–1984), American chemist and early nutritionist, and the first person to isolate Vitamin E Emil Erlenmeyer (1825–1909), German chemist known for the early development of the theory of chemical structure and formulating the Erlenmeyer rule. Richard R. Ernst (1933–2021), Swiss physical chemist, 1991 Nobel Prize in Chemistry for the development of Fourier transform nuclear magnetic resonance spectroscopy Gerhard Ertl (born 1936), German physical chemist who laid the foundation of modern surface chemistry, 2007 Nobel prize in chemistry Margaret C. Etter (1943–1992), American chemist and developer of solid state chemistry for crystalline organic compounds Hans von Euler-Chelpin (1873–1964), Swedish chemist, winner of the 1929 Nobel Prize in Chemistry for work on the fermentation of sugar and enzymes Henry Eyring (1901–1981), Mexico-born American theoretical chemist known for the absolute rate theory of chemical reactions
=== Antibacterial spectrum === Colistin has been effective in treating infections caused by Pseudomonas, Escherichia, and Klebsiella species. The following represents minimum inhibitory concentration (MIC) susceptibility data for a few medically significant microorganisms:
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
It is a tripeptide rather than a full protein. Proteins generally contain many amino acids joined by alpha-peptide bonds, while glutathione has three residues and an unusual gamma-glutamyl linkage. That structure affects how enzymes recognize and break it down.
GSH is the reduced form with a free thiol group. GSSG is the oxidized disulfide dimer formed when two GSH molecules react. The GSH-to-GSSG ratio is used in research as one indicator of cellular redox conditions.
Yes, it is present in many animal and plant tissues, including meats, some vegetables, and fruits. Heat, storage, and processing can reduce its content, so measured amounts vary widely.
Glutathione is a tripeptide of three amino acids: glutamate, cysteine, and glycine. The cysteine residue provides the sulfhydryl group that gives the molecule its reducing properties.