The short version of NAMPT fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-10-06. Anything still debated is marked as such rather than presented as settled.
NMN is present in small amounts in various foods, including certain vegetables, fruits, and milk, though dietary quantities are generally low. Laboratory research often uses synthetic or enzymatically produced NMN. The compound has drawn interest because NAD+ levels decline with age in some tissues and because restoring NAD+ may affect metabolism in animal models. Whether oral NMN produces meaningful NAD+ increases in humans and whether such changes translate into health benefits are not fully established.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide base with a ribose sugar and a phosphate group. Within cells, NMN sits on the biosynthetic route that recycles nicotinamide back into nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in redox reactions and signaling, enzymes that produce and consume it influence many metabolic processes. The compound is therefore best described as an intermediate rather than a final signaling molecule.
NMN occurs in many living systems, including bacteria, yeast, plants, and mammals. Dietary sources are present in foods such as edamame, avocado, broccoli, and various meats, but amounts vary widely and are generally lower than those used in research settings. Laboratory production often relies on enzymatic synthesis or chemical phosphorylation of nicotinamide riboside, and commercial material is typically supplied as a white to off-white powder. Because NMN is hygroscopic and sensitive to heat, moisture, and pH extremes, its handling requires care to preserve identity and purity. Aqueous preparation should be done with attention to pH and temperature to limit hydrolysis.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
| Property | Value | Notes |
|---|---|---|
| Chemical name | Nicotinamide mononucleotide | Abbreviated NMN |
| Molecular formula | C11H15N2O8P | Neutral form |
| Molar mass | 334.22 g/mol | Approximate value |
| Appearance | White to off-white powder | Typical solid form |
| Solubility | Water-soluble | May absorb moisture |
Inside cells, the enzyme nicotinamide phosphoribosyltransferase, or NAMPT, converts nicotinamide and a ribose-phosphate donor into NMN. A second enzyme, NMN adenylyltransferase, then converts NMN into NAD+. NAD+ participates in redox reactions and serves as a substrate for signaling enzymes such as sirtuins, PARPs, and CD38. Because NAD+ levels tend to decline with age in many organisms, NMN has drawn interest as a possible way to influence that decline. Whether oral NMN reliably raises NAD+ in human tissues, and whether any such change modifies disease risk, remain open research questions.
NMN is present in small amounts in some foods, including certain vegetables, fruits, and animal products, but food content varies widely and is not well standardized. In laboratory research, NMN is used as a tool compound to study NAD+ metabolism, mitochondrial function, and cellular stress responses. Animal studies have reported changes in NAD+ levels and various physiological measures after NMN administration, but species differences and study designs limit direct extrapolation to humans. Human trials have largely focused on safety, tolerability, and pharmacokinetics, with fewer studies examining clinical endpoints.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide ring attached to a ribose sugar that carries a phosphate group. The molecular formula is C11H15N2O8P, and the molar mass is about 334.22 grams per mole. In cells, NMN is an intermediate in the salvage pathway that recycles nicotinamide to maintain NAD+ levels. It is not the same compound as NAD+, although it is a direct precursor in one enzymatic step.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
I was expecting to retrieve the body from a fridge in the mortuary, but... it was stored in a body bag that was kept on the floor of a garage away from the main hospital building. She was in a transparent body bag packed with wood shavings and sawdust. There was also some kind of liquid and I remember that I was frightened that the bag would split open. The body was covered in sores and scars – it was quite horrific. I was on my own and I needed help to lift the body... but I managed to get her into the van. People from the hospital were very wary of helping me... When the day of the funeral arrived, the cars were given an escort by unmarked police vehicles just in case there was an accident... The body had to be cremated because there was a chance the virus could have thrived in the ground if Mrs Parker had been buried. All other funerals were cancelled that day and the Robin Hood Crematorium was thoroughly cleaned afterwards. Concerns over the survival of infectious virus in Parker's body were well-founded, and at the inquest the coroner, who signed Parker's cremation certificate, disallowed an autopsy for safety reasons.
An alpha helix (or α-helix) is a sequence of amino acids in a protein that are twisted into a coil (a helix). The alpha helix is the most common structural arrangement in the secondary structure of proteins. It is also the most extreme type of local structure, and it is the local structure that is most easily predicted from a sequence of amino acids. The alpha helix has a right-handed helix conformation in which every backbone N−H group hydrogen bonds to the backbone C=O group of the amino acid that is four residues earlier in the protein sequence. The alpha helix is also commonly called a: Pauling–Corey–Branson α-helix (from the names of three scientists who described its structure) 3.613-helix because there are 3.6 amino acids in one ring, with 13 atoms being involved in the ring formed by the hydrogen bond (starting with amidic hydrogen and ending with carbonyl oxygen)
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
In 1961, Peter Mitchell proposed chemiosmosis as a cell's primary system of energy conversion. The mechanism, now ubiquitous in living cells, powers energy conversion in micro-organisms and in the mitochondria of eukaryotes, making it a likely candidate for early life. Mitochondria produce adenosine triphosphate (ATP), the energy currency of the cell used to drive cellular processes such as chemical syntheses. The mechanism of ATP synthesis involves a closed membrane in which the ATP synthase enzyme is embedded. The energy required to release strongly bound ATP has its origin in protons that move across the membrane. In modern cells, those proton movements are caused by the pumping of ions across the membrane, maintaining an electrochemical gradient. In the first organisms, the gradient could have been provided by the difference in chemical composition between the flow from a hydrothermal vent and the surrounding seawater, or perhaps meteoric quinones that were conducive to the development of chemiosmotic energy across lipid membranes if at a terrestrial origin.
Methanogens rely on such enzymes to catalyze the reduction of CO2 to methane. One step in methanogenesis entails conversion of a methenyl group (formic acid oxidation state) to a methylene group (formaldehyde oxidation state). Among the hydrogenase family of enzymes, Hmd is unique in that it does not directly reduce CO2 to CH4. The natural substrate of the enzyme is the organic compound methenyltetrahydromethanopterin. The organic compound includes a methenyl group bound to two tertiary amines. The methenyl group originated as CO2 before being incorporated into the substrate, which is catalytically reduced by H2 to methylenetetrahydromethanopterin as shown. Eventually the methylene group is further reduced and released as a molecule of methane. The hydride transfer has also been shown to be stereospecific. Given that the substrate is planar the hydride originating from H2 is always added to the pro-R face. In the reverse reaction stereospecificity is maintained and the highlighted hydride is removed.
Sources: en.wikipedia.org
Human chorionic gonadotropin (hCG) is a hormone for the maternal recognition of pregnancy produced by trophoblast cells that are surrounding a growing embryo (syncytiotrophoblast initially), which eventually forms the placenta after implantation. The presence of hCG is detected in some pregnancy tests (HCG pregnancy strip tests). Some cancerous tumors produce this hormone; therefore, elevated levels measured when the patient is not pregnant may lead to a diagnosis of cancer and, if high enough, of paraneoplastic syndromes. It is unknown however whether this production is a contributing cause or an effect of carcinogenesis. The pituitary analogue of hCG, luteinizing hormone (LH), is produced in the pituitary gland of males and females of all ages. Beta-hCG is initially secreted by the syncytiotrophoblast.
In botany, apical dominance is the phenomenon whereby the main, central stem of the plant is dominant over (i.e., grows more strongly than) other side stems; on a branch the main stem of the branch is further dominant over its own side twigs. Plant physiology describes apical dominance as the control exerted by the terminal bud (and shoot apex) over the outgrowth of lateral buds.
In over one hundred years of implementation, aviation safety has improved considerably. In modern times, two major manufacturers still produce heavy passenger aircraft for the civilian market: Boeing in the United States, and the European company Airbus. Both of these manufacturers place a huge emphasis on the use of aviation safety equipment, now a billion-dollar industry in its own right; safety is a key selling point for these companies, as they recognize that a poor safety record in the aviation industry is a threat to corporate survival. Some major safety devices now required in commercial aircraft are:
Prior to founding the Center for Biomedical Mass Spectrometry at Boston University School of Medicine in 1994, Costello was a senior research scientist and the associate director of the National Institutes of Health Research Resource for Mass Spectrometry at Massachusetts Institute of Technology for 20 years. She is a William Fairfield Warren Distinguished Professor and the director of the Center for Biomedical Mass Spectrometry at the Boston University School of Medicine. Costello served as the president of the American Society for Mass Spectrometry (2002–2004), the Human Proteome Organization (2011–2012), and the International Mass Spectrometry Foundation (2014–2018). She currently serves on the board of directors of the US Human Proteome Organization, and the editorial board of Clinical Proteomics.
Sources: en.wikipedia.org
This technology entails the joining of DNA from different species and the subsequent insertion of the hybrid DNA into a host cell. One of the first individuals to develop recombinant DNA technology was a biochemist at Stanford by the name of Paul Berg. In his experimental design in 1974, he cleaved (cut into fragments) the monkey virus SV40. He then cleaved the double helix of another virus, an antibacterial agent known as bacteriophage lambda. In the third step, he fastened DNA from the SV40 to DNA from the bacteriophage lambda. The final step involved placing the mutant genetic material into a laboratory strain of the E. coli bacterium. This last step, however, was not completed in the original experiment.
Clustal Omega is a multiple sequence alignment (MSA) tool that enables to find an optimal alignment of at least three and maximum of 4000 input DNA and protein sequences. Clustal Omega algorithm employs two profile Hidden Markov models (HMMs) to derive the final alignment of the sequences. The output of the Clustal Omega may be visualized in a guide tree (the phylogenetic relationship of the best-pairing sequences) or ordered by the mutual sequence similarity between the queries. The main advantage of Clustal Omega over other MSA tools (Muscle, ProbCons) is its efficiency, while maintaining a significant accuracy of the results.
The Bergmann degradation is intended for and has been used as a method for peptide sequencing. It was also proposed for use in cleaving the 3,4-bond of the penicillin nucleus. The compound 2,2-dimethyl-6-phthalimido-3-penamyl isocyanate was arrived at through various means, including the Curtius rearrangement, and it was envisioned that it could undergo the Bergmann degradation to form the desired aldehyde as well as the urea by-product. Though the Bergmann degradation was indeed possible, it was discovered that simple dilute acid hydrolysis would suffice in forming the desired product.
Previously, many studies used Mass Spectrometry (MS) in different fragmentation modes to detect AMPylated peptides. In responses to the distinctive fragmentation techniques, AMPylated protein sequences disintegrated at different parts of AMP. While electron transfer dissociation (ETD) creates minimum fragments and less complicated spectra, collision-induced dissociation (CID) and high-energy collision (HCD) fragmentation generate characteristic ions suitable for AMPylated proteins identification by generating multiple AMP fragments. Due to AMP's stability, peptide fragmentation spectra is easy to read manually or with search engines. Inhibitors of protein AMPylation with inhibitory constant (Ki) ranging from 6 - 50 μM and at least 30-fold selectivity versus HypE have been discovered.
The histology of ALK-negative ALCL, similar to ALK-positive ALCL, consist of "hallmark" cells that strongly express CD30. Unlike ALK-positive ALCL, however, ALK-negative ALC does not fall into different morphological patterns. The histological of this disease may overlap with and be difficult to distinguish from other CD30-positive T-cell lymphomas or the nodular sclerosis form of Hodgkin lymphoma. Cases in which ALK-negative ALCL is not distinguishable from the latter lymphomas are best diagnosed as peripheral T-cell lymphoma not otherwise specified (PTL, NOS). The histology of ALK-negative ALCL may also overlap with tumors of non–T-cell lineage such as various carcinomas. The differential diagnoses of ambiguous cases may be helped by examining the tumor cells for the expression of certain marker proteins. For example, expression of CD56, MUC1 (also termed EMA for epithelial membrane antigen), and clusterin and strong uniform expression of CD30 support the diagnosis of ALK-negative ALCL over PTL, NOS, while variable CD30 expression and extensive expression of T-cell receptor proteins favor PTCL-NOS over ALK-negative ALCL. Detection of certain gene abnormalities (see next section) may also help distinguishing these diseases.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It occurs naturally in cells and is also produced commercially as a supplement ingredient.
No. NMN is a precursor that can be converted into NAD+, while NAD+ is a dinucleotide coenzyme involved in redox reactions and signaling.
Small amounts have been reported in foods such as edamame, avocado, broccoli, and milk. Dietary amounts are generally much lower than those used in research studies.
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It consists of nicotinamide, ribose, and phosphate groups.