The short version of derivatization fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-02-11. Anything still debated is marked as such rather than presented as settled.
Quality control for glutathione measurements includes calibration with authenticated standards, internal standards where available, blank correction, and spike recovery checks. Because glutathione can form during sample processing or degrade before analysis, pre-analytical handling is a major source of variability. Interlaboratory comparisons often show differences in reported values due to method-specific calibration and detection principles. Interpretive thresholds are context-dependent, and no single reference range applies across all tissues or matrices. Researchers generally report both reduced and oxidized forms, along with the method and sample handling details.
Quantification of glutathione in biological or food samples commonly uses liquid chromatography coupled to ultraviolet, fluorescence, electrochemical, or mass spectrometric detection. Because the thiol group oxidizes readily, samples are often acidified or derivatized immediately after collection to stabilize reduced glutathione. Enzymatic recycling assays and colorimetric kits offer higher throughput but generally lower specificity than chromatographic methods. Mass spectrometry can distinguish glutathione from related thiols and allow simultaneous measurement of oxidized forms. Reported concentrations depend strongly on sample type, extraction procedure, and analytical platform.
Glutathione is most stable as a dry powder stored cool and dry, but its thiol group is readily oxidized in solution. Aqueous preparations at neutral or alkaline pH lose GSH faster because the thiolate form reacts with dissolved oxygen and metal ions. Acidic conditions, chelating agents, and oxygen exclusion can slow oxidation, while repeated freeze-thaw cycles promote degradation. Light exposure and trace metals also contribute to loss. Laboratories typically validate stability for their own matrices because degradation rates depend on pH, temperature, concentration, and container materials.
Commercial glutathione is available in research-grade, food-grade, and supplement-grade forms, and purity specifications differ accordingly. Certificates of analysis commonly report identity by nuclear magnetic resonance or mass spectrometry, purity by HPLC, residual solvents, and heavy metals. Reference standards with assigned purity support calibration, while isotopically labeled glutathione can serve as an internal standard for mass spectrometry. For supplements, label claims may not be independently verified, and regulatory oversight varies by country. Verification often involves third-party testing for identity, potency, and contaminants.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | Desiccated solid; protect from light |
| Solubility | Soluble in water | Forms acidic solutions |
| Typical analytical method | LC-MS/MS | High specificity for thiols |
| Detection wavelength | 210–220 nm | For HPLC-UV of underivatized glutathione |
| Common synonyms | GSH; reduced glutathione | GSH refers to the reduced form |
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. The enzymatic recycling assay uses glutathione reductase and a colorimetric or fluorometric reagent to amplify signal, which gives good sensitivity for total glutathione. Chromatographic methods can separate GSH from GSSG and related thiols, while mass spectrometry offers structural confirmation and multiplexing. Each approach has different requirements for calibration, internal standards, and validation. No single method captures every form of glutathione in every matrix.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Storage conditions strongly influence glutathione stability. The solid reduced form is commonly kept desiccated at or below minus twenty degrees Celsius, protected from light and moisture. Aqueous solutions are less stable because the thiol group reacts with dissolved oxygen, and oxidation accelerates at neutral or alkaline pH. Acidic solutions and oxygen-free handling can slow degradation, but repeated freeze-thaw cycles should be avoided. Researchers often verify concentration before use, because apparent losses can arise from oxidation or water uptake.
Measuring glutathione in biological samples requires attention to oxidation and matrix effects. High-performance liquid chromatography with ultraviolet or fluorescence detection can separate reduced and oxidized forms after derivatization. Liquid chromatography with tandem mass spectrometry offers higher specificity and can quantify glutathione alongside related thiols. Because glutathione can oxidize during sample handling, many protocols use rapid acidification with metaphosphoric acid or sulfosalicylic acid. Internal standards help correct for losses during extraction and analysis.
Enzymatic recycling assays provide a complementary approach for total glutathione. In these methods, glutathione reductase reduces oxidized glutathione while a thiol-reactive reagent, such as 5,5'-dithiobis(2-nitrobenzoic acid), produces a colored product. The reaction cycles between reduced and oxidized forms, amplifying the signal. Spectrophotometric or fluorometric detection can then estimate concentration. Distinguishing reduced glutathione from glutathione disulfide often requires separate aliquots, masking agents, or chromatographic separation, and the choice affects reported values.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. Enzymatic recycling measures total glutathione after converting GSSG back to GSH, while separation methods can quantify GSH and GSSG separately. Derivatization may be used to improve detection or stability during analysis. LC-MS/MS offers high specificity and can distinguish glutathione from related thiols and adducts. Each method has different sensitivity, throughput, and susceptibility to interference, so method selection depends on the study question and sample matrix.
For solid glutathione reagents, storage at low temperature and protection from moisture and light are typical precautions. Aqueous solutions can oxidize over time, and pH affects stability; alkaline conditions generally promote thiol oxidation. Some protocols prepare fresh solutions, while others use antioxidants or chelators to limit metal-catalyzed oxidation. Purity and counterion content can vary among commercial preparations, affecting concentration calculations. Certificates of analysis and validated assays help verify identity and purity.
=== Development === Parafollicular cells are derived from pharyngeal endoderm. Embryologically, they associate with the ultimopharyngeal body, which is a ventral derivative of the fourth (or fifth) pharyngeal pouch. Parafollicular cells were previously believed to be derived from the neural crest based on a series of experiments in quail-chick chimeras. However, lineage tracing experiments in mice revealed that parafollicular cells are derived from the endoderm origin.
=== Kevin: Hair Today, Gone Tomorrow === First aired: 9 December 2010 Meet Kevin, a bully who calls himself a natural. He is a hair-obsessed greaser that makes life miserable for his victims, Anthony and Sam. Mayhem Miller recruits Amateur Wrestler and MMA fighter Tyron Woodley to beat him down. Kevin makes a bet with Mayhem that if he loses all $10,000, he has to cut his hair. In the first round, he tapped out four times and barely escapes with $1,000 with a bruised ego. In the second round, he got TKO'd. Despite technically being allowed to keep his hair, as part of Kevin's apology, he allows Mayhem to cut his hair. Anthony and Sam won $9,000.
Dry needling, also known as trigger point dry needling and intramuscular stimulation, is a treatment technique used by various healthcare practitioners, including physical therapists, physicians, and chiropractors, among others. Acupuncturists usually maintain that dry needling is adapted from acupuncture, but others consider dry needling as a variation of trigger point injections. It involves the use of either solid filiform needles or hollow-core hypodermic needles for therapy of muscle pain, including pain related to myofascial pain syndrome. Dry needling is mainly used to treat myofascial trigger points, but it is also used to target connective tissue, neural ailments, and muscular ailments. The American Physical Therapy Association defines dry needling as a technique used to treat dysfunction of skeletal muscle and connective tissue, minimize pain, and improve or regulate structural or functional damage. There is conflicting evidence regarding the effectiveness of dry needling. Some results suggest that it is an effective treatment for certain kinds of muscle pain, while other studies have shown no benefit compared to a placebo; however, not enough high-quality, long-term, and large-scale studies have been done on the technique to draw clear conclusions about its efficacy. Currently, dry needling is being practiced in the United States, Canada, Europe, Australia, and other parts of the world.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
=== Kentucky === In 2005, a bill was introduced that would require 80 hours of didactic and practical training, plus 50 hours of clinical training, and certification as a phlebotomy technician for phlebotomy, that did not pass.
== Safety == TCFH does not irritate skin but is a potent eye irritant. The sensitization potential of TCFH was shown to be low compared to other amide bond forming agents, which can be used in the context of peptide synthesis (it is non-sensitizing at 1% in the local lymph node assay according to OECD 429). The major by-product of using TCFH is tetramethylurea, which has demonstrated teratogenic activity in several laboratory animal species.
Common barbiturate side effects include nausea, hypotension, headache, drowsiness, and skin rash. More serious side effects can include confusion, slow breathing, hallucination, fainting, and coma. Rare side effects may include agranulocytosis, liver injury, megaloblastic anemia, or Stevens-Johnson Syndrome.
Sources: en.wikipedia.org
== Further reading == Bolsmann, Chris (1 November 2021). "'Playing With Apartheid': Irish and South African Rugby, 1964–19891". Sport History Review. 52 (2): 262–278. doi:10.1123/shr.2020-0027. S2CID 235043351. Booth, Douglas (1 July 2003). "Hitting Apartheid for Six? The Politics of the South African Sports Boycott". Journal of Contemporary History. 38 (3): 477–493. doi:10.1177/0022009403038003008. S2CID 145730533. Booth, Douglas (2013). "Recapturing the Moment? Global Rugby, Economics and the Politics of Nation in Post-Apartheid South Africa". In Chandler, Timothy J.L.; Nauright, John (eds.). Making the Rugby World. pp. 181–200. doi:10.4324/9781315036984. ISBN 978-1-135-22722-7. Nixon, Rob (1992). "Apartheid on the Run: The South African Sports Boycott". Transition (58): 68–88. doi:10.2307/2934968. JSTOR 2934968. Snyders, Hendrik (3 July 2018). "'An Outrage, Not Athletics': Apartheid and South African–United States Rugby Relations, 1976–1990". The International Journal of the History of Sport. 35 (10): 1029–1059. doi:10.1080/09523367.2019.1576636. S2CID 150831234. Snyders, Hendrik (2022). "Rugby, reconciliation, and post-apartheid public memory". Sport in Museums. pp. 80–91. doi:10.4324/9781351117944-6. ISBN 978-1-351-11794-4.
Labour MP Tam Dalyell commented in Galloway's defence: "I think he is a deeply serious, committed politician and a man of great sincerity about the causes he takes up." On 6 May 2003, David Triesman, then general secretary of the Labour Party, suspended Galloway from holding office in the party pending a hearing on charges that he had violated the party's constitution by "bringing the Labour Party into disrepute through behaviour that is prejudicial or grossly detrimental to the Party." Galloway said he stood by every word of the Abu Dhabi interview. The National Constitutional Committee, responsible for disciplinary matters in the Labour Party, held a hearing on 22 October 2003 to consider the charges, taking evidence from Galloway himself, from other party witnesses, viewing media interviews, and hearing character testimony from former cabinet minister Tony Benn, among others. The following day, the committee unanimously found Galloway guilty of four of the five charges: inciting Arabs to fight British troops, inciting British troops to defy orders, inciting voters to reject Labour MPs, and threatening to stand against Labour. Galloway was expelled from the Labour Party. Galloway said after his expulsion: "This was a politically motivated kangaroo court whose verdict had been written in advance in the best tradition of political show trials". He claimed that other MPs who opposed the war, such as Bob Marshall Andrews and Glenda Jackson, would soon be expelled, but no other MP was expelled from the Labour Party for opposing the Iraq War.
Later in the 20th century several British pathologists, Mikey Rochman, Francis Camps, Sydney Smith and Keith Simpson pioneered new forensic science methods. Alec Jeffreys pioneered the use of DNA profiling in forensic science in 1984. He realized the scope of DNA fingerprinting, which uses variations in the genetic code to identify individuals. The method has since become important in forensic science to assist police detective work, and it has also proved useful in resolving paternity and immigration disputes. DNA fingerprinting was first used as a police forensic test to identify the rapist and killer of two teenagers, Lynda Mann and Dawn Ashworth, who were both murdered in Narborough, Leicestershire, in 1983 and 1986 respectively. Colin Pitchfork was identified and convicted of murder after samples taken from him matched semen samples taken from the two dead girls.
The above-ground nuclear tests that occurred in several countries in 1955-1980 (see List of nuclear tests) dramatically increased the amount of 14C in the atmosphere and subsequently the biosphere; after the tests ended, the atmospheric concentration of the isotope began to decrease, as radioactive CO2 was fixed into plant and animal tissue, and dissolved in the oceans. One side-effect of the change in atmospheric 14C is that this has enabled some options (e.g. bomb-pulse dating) for determining the birth year of an individual, in particular, the amount of 14C in tooth enamel, or the carbon-14 concentration in the lens of the eye. In 2019, Scientific American reported that carbon-14 from nuclear testing has been found in animals from one of the most inaccessible regions on Earth, the Mariana Trench in the Pacific Ocean. The concentration of 14C in atmospheric CO2, reported as the 14C/12C ratio with respect to a standard, has (since about 2022) declined to levels similar to those prior to the above-ground nuclear tests of the 1950s and 1960s. Though the extra 14C generated by those nuclear tests has not disappeared from the atmosphere, oceans and biosphere, it is diluted due to the Suess effect.
Sources: en.wikipedia.org
Acidification lowers pH and helps prevent oxidation of the thiol group during extraction and storage. It can also precipitate proteins and stabilize the reduced form before analysis.
Blood contains glutathione, but concentrations differ between plasma and red blood cells. Careful separation and rapid processing are needed because ex vivo oxidation and hemolysis can alter results.
An enzymatic recycling assay uses glutathione reductase and a thiol-reactive reagent to generate a signal proportional to total glutathione. It is convenient for many samples but may not distinguish reduced and oxidized forms without additional steps.
The ratio depends on rapid separation or blocking of GSH before oxidation occurs. GSSG can be formed ex vivo if samples are not processed quickly in cold, acidic conditions. Even small delays can shift the apparent ratio, making standardized protocols essential.