If you have been reading about sample preparation and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-07-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Synthesis occurs in two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine to form gamma-glutamylcysteine, and glutathione synthetase adds glycine to complete the tripeptide. The pathway is feedback-inhibited by GSH and limited by cysteine availability, so cysteine supply often constrains production. Once formed, GSH participates in redox buffering, xenobiotic conjugation, and protein glutathionylation. Glutathione peroxidase uses GSH to reduce hydrogen peroxide and lipid peroxides, yielding GSSG, while glutathione reductase regenerates GSH using NADPH. Glutathione S-transferases conjugate electrophiles to GSH, supporting detoxification and excretion.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
Accurate measurement of glutathione begins with careful sample handling. Because GSH oxidizes rapidly to GSSG, samples must be processed quickly or frozen immediately. Acid precipitation with metaphosphoric acid or perchloric acid is common; it lowers pH, precipitates proteins, and helps preserve the reduced form. Chelating agents such as EDTA can limit metal-catalyzed oxidation. For whole blood, hemolysis releases glutathione from erythrocytes, so plasma and serum values differ substantially from whole blood values.
Several analytical methods can quantify glutathione, including high-performance liquid chromatography (HPLC) with UV or fluorescence detection for separating GSH and GSSG. Liquid chromatography-tandem mass spectrometry (LC-MS/MS) offers higher specificity and sensitivity, often detecting nanomolar concentrations. The enzymatic recycling assay, often called the Tietze method, measures total glutathione by coupling reduction of GSSG to a colorimetric or fluorometric readout. Capillary electrophoresis and electrochemical detection are also used in specialized laboratories. Each method has distinct advantages and limitations regarding throughput, cost, and susceptibility to interference.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Tripeptide of glutamate, cysteine, and glycine. |
| Molar mass | 307.32 g/mol | Calculated from the molecular formula. |
| Appearance | White to off-white powder | Typically crystalline or lyophilized solid. |
| Solubility | Soluble in water; insoluble in ethanol | Aqueous solutions are acidic and prone to oxidation. |
| Typical storage | -20 °C, desiccated, protect from light | Reduce exposure to oxygen and moisture. |
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group. This unusual linkage protects the molecule from many common peptidases. The cysteine side chain carries a thiol group that can undergo reversible oxidation. Because of this thiol, glutathione participates in redox reactions and helps maintain the reducing environment inside most cells in living systems.
In cells, glutathione exists mainly in a reduced form called GSH. When two GSH molecules react, they form oxidized glutathione, or GSSG, which contains a disulfide bond. The ratio of GSH to GSSG is often used as an indicator of oxidative stress. Enzymes such as glutathione peroxidase and glutathione reductase help cycle the molecule between these two states. This cycling supports antioxidant defense, detoxification of reactive molecules, and regulation of certain signaling pathways.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It contains an unusual gamma-glutamyl bond between glutamate and cysteine, which resists cleavage by many peptidases. The reduced form, GSH, carries a thiol group on cysteine and is the dominant intracellular form in most cells. Its structure allows it to participate in redox reactions and to serve as a sulfur donor. The oxidized form, GSSG, consists of two GSH molecules joined by a disulfide bond.
In cells, glutathione helps maintain the reducing environment of the cytosol and supports enzymes that counteract reactive oxygen species. It acts as a cofactor for glutathione peroxidases, which reduce hydrogen peroxide and lipid peroxides, and for glutathione S-transferases, which conjugate electrophiles. The ratio of GSH to GSSG is often used as an indicator of oxidative stress, although the ratio can vary by compartment and cell type. Glutathione also stores cysteine, an amino acid that can be limiting for protein synthesis and antioxidant defense.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its glutamate-cysteine linkage uses the gamma-carboxyl group of glutamate, a feature that resists standard peptidases. The cysteine residue provides a thiol group, which gives the molecule its reducing character. In cells, glutathione is often the most abundant small-molecule thiol, with concentrations varying widely by tissue and compartment. It exists mainly in a reduced form called GSH, while oxidation produces a disulfide-linked dimer called GSSG.
Biosynthesis proceeds in two ATP-dependent steps. First, glutamate-cysteine ligase joins glutamate and cysteine. Second, glutathione synthetase adds glycine to the intermediate. The pathway is regulated by cysteine availability, enzyme expression, and feedback inhibition by glutathione itself. Liver tissue has a particularly high capacity for synthesis and export. Because the molecule is made inside cells, circulating glutathione reflects a balance of release, uptake, and breakdown rather than simple dietary supply.
== External links == "Carol Robinson's Interview with Denis Noble". YouTube. voicesfromoxfordUK. 18 December 2013. (See Denis Noble.) "A New Phase for Structural Biology – with Carol Robinson". YouTube. The Royal Institution. 6 July 2016. "Mass spectrometry: From ribosomes to receptors | Prof Dame Carol Robinson DBE FRS FMedSci". YouTube. Cambridge SciSoc. 26 March 2021. "Carol Vivien, DBE, FRS, FMedSci ~ 10/14/2020 – Physiology Bashour Speaker". YouTube. UTSW Department of Physiology. 29 March 2021. "JACS in Conversation with Professor Dame V. Robinson". YouTube. ACS Productions. 7 September 2021. (interview conducted by Erick M. Carreira)
It is unclear that cyproheptadine achieves adequate serotonin 5-HT2A receptor occupancy at the assessed doses. Further complicating the picture, high doses of cyproheptadine have been reported to produce partial LSD-like discriminative stimulus effects in animals.
20 September – Scientists who reported the earliest known interstellar object, CNEOS 2014-01-08, and members of The Galileo Project, report the discovery of an additional candidate interstellar meteor, CNEOS 2017-03-09, in a preprint using the same fireball catalog. They find that the implied material strength of the two objects suggests that interstellar meteors "come from a population with material strength characteristically higher than meteors originating from within the solar system". 21 September – Engineers report the development of autonomous 3D-printing drones for construction and repair. 22 September Nanoengineers report the development of biocompatible microalgae hybrid microrobots for active drug-delivery in the lungs (22 Sep.) and the gastrointestinal tract (GT) (28 Sep.). The microrobots are related to medical nanobots and proved effective in tests with mice. A separate team reports the development of 'RoboCap', a robotic drug delivery capsule that enhances drug absorption by tunneling through the mucus layer in the GT (28 Sep.). Around September, news outlets report about deployment, research and development of novel military drone technology in the Russo-Ukrainian War in 2022, including demining drones, self-repurposed commercial/hobby drones (including via a hackathon), reconnaissance microdrones, kamikaze drones, bomb-dropping modified drones, and countermeasures such as electronic ones.
Sources: en.wikipedia.org
The superoxide ion, O−2 is generated in biological systems by reduction of molecular oxygen. It has an unpaired electron, so it behaves as a free radical. It is a powerful oxidizing agent. These properties render the superoxide ion very toxic and are deployed to advantage by phagocytes to kill invading microorganisms. Otherwise, the superoxide ion must be destroyed before it does unwanted damage in a cell. The superoxide dismutase enzymes perform this function very efficiently. The formal oxidation state of the oxygen atoms is −1⁄2. In solutions at neutral pH, the superoxide ion disproportionates to molecular oxygen and hydrogen peroxide.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Since then, treatment had continued in the cities that participated in the pilot study, until heroin maintenance was permanently included into the national health system in May 2009. As of 2021, the country offers heroin-assisted treatment by prescribing medical-grade heroin is typically prescribed in combination with methadone and psychosocial counseling. A heroin maintenance programme has existed in the United Kingdom (UK) since the 1920s, as drug addiction was seen as an individual health problem. Addiction to opiates was rare in the 1920s and was mostly limited to either middle-class people who had easy access due to their profession, or people who had become addicted as a side effect of medical treatment. In the 1950s and 1960s a small number of doctors contributed to an alarming increase in the number of people who are experiencing addiction in the U.K. through excessive prescribing—the U.K. switched to more restrictive drug legislation as a result. However, the British government is again moving towards a consideration of heroin prescription as a legitimate component of the National Health Service (NHS). Evidence has shown that methadone maintenance is not appropriate for all people who are dependent on opioids and that heroin is a viable maintenance drug that has shown equal or better rates of success. A committee appointed by the Norwegian government completed an evaluation of research reports on heroin maintenance treatment that were available internationally.
Sources: en.wikipedia.org
=== NutraSweet Company === In 1985, Monsanto bought G.D. Searle, and the aspartame business became a separate Monsanto subsidiary, NutraSweet. In March 2000, Monsanto sold it to J.W. Childs Associates Equity Partners II L.P. European use patents on aspartame expired beginning in 1987, with the US patent following suit in 1992.
However, Georgiev already has limited influence in the government and pressure against Velchev was increasing. On 2 July the Communists passed for one day a law on control of the army, seizing powers from the war minister at the expense of the Council of Ministers. On 2 August, Kimon Georgiev agreed to the removal of his close associates Kiril Stanchev (arrested and convicted in a show trial) and Damyan Velchev (effectively replaced as minister by Krum Lekarski and interned). From 11 August to 3 September, Kimon Georgiev was in Paris at the head of a Bulgarian delegation preparing the Paris Peace Treaty. There he met with various politicians, including the foreign ministers of the Soviet Union, Vyacheslav Molotov, and the United States, James Byrnes. Bulgaria unsuccessfully insisted on being recognized as a country that had fought against Germany, but with the support of the Eastern Bloc countries, it managed to significantly reduce the reparations demanded by Greece. Upon his return to Bulgaria, Kimon Georgiev managed to personally solicit protections for Damyan Velchev from Georgi Dimitrov. On 25 September, Georgiev nominally became head of the War Ministry, and Velchev was sent as ambassador to Switzerland, avoiding for the moment a show trial. In September–November 1946, Georgiev was in charge of the War Ministry. During this period, he was promoted to the rank of colonel general. On 5 October 1946, at a rally in Sofia, Kimon Georgiev opened the Fatherland Front's election campaign for the election of the Sixth Grand National Assembly.
The allegation along with the article forces Jim's editor Edward Burgess to fire him; Jim subsequently meets Rishi at a bar, and the two go on a cocaine bender at the latter's apartment along with Dez Watkins, a man they met at the bar. Watkins gives them drugs and turns up the volume on Rishi's stereo before leaving, inciting a noise complaint that draws police to the apartment right as Jim overdoses and dies. Jim's death is later confirmed to be a murder, with Watkins revealed as an agent of Russian foreign intelligence who gave Jim cocaine laced with fentanyl.
Sources: en.wikipedia.org
GSH is the reduced, thiol-containing form of glutathione, while GSSG is the oxidized disulfide dimer formed when two GSH molecules react. Cells maintain a high GSH-to-GSSG ratio under normal conditions. A shift toward GSSG is often interpreted as oxidative stress, though sample handling can affect the measured ratio.
No. It is a tripeptide made from three amino acids: glutamate, cysteine, and glycine. The gamma-glutamyl bond is unusual and distinguishes it from typical peptide linkages.
Most ingested glutathione is broken down in the gastrointestinal tract into its constituent amino acids. Some formulations may protect it from digestion, but intact absorption and delivery to specific tissues remain uncertain. Research continues on precursors and delivery methods.
Glutathione oxidizes quickly when cells are disrupted or when samples sit at room temperature. Rapid processing or immediate freezing minimizes the conversion of GSH to GSSG. This step helps ensure that the measured ratio reflects the original biological state.